HPA004098

ZIC1 antibody from Sigma-Aldrich
ZIC, ZNF201
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004098
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004098, RRID:AB_1859065
Product name
Anti-ZIC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004098
Antibody type
Polyclonal
Antigen
Zinc finger protein ZIC 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGINPFADGMGAFKLNPSSHELASAGQTAFTSQAP
GYAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRN
RGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAG
HLLFPGLHEQA
Storage
-20C
Provider Type Product Number
- No reagents -