PAB21257

PTRHD1 antibody from Abnova Corporation
C2orf79, LOC391356

Antibody data

Product number
PAB21257
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21257, RRID:AB_10964557
Product name
PTRHD1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21257
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant PTRHD1.
Antigen sequence
GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLE
QPENIATCIALRPYPKEEVGQYLKKFRLFK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -