HPA023010

TTC19 antibody from Sigma-Aldrich
FLJ20343, MGC19520
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023010
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023010, RRID:AB_1858429
Product name
Anti-TTC19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023010
Antibody type
Polyclonal
Antigen
Tetratricopeptide repeat protein 19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FCISTLEEKIEREKELAEDIMSVEEKANTHLLLGM
CLDACARYLLFSKQPSQAQRMYEKALQISEEIQGE
R
Storage
-20C
Provider Type Product Number
- No reagents -