HPA004099

PI4K2B antibody from Atlas Antibodies
FLJ11105, PI4KIIB, PIK42B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004099
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004099, RRID:AB_1235225
Product name
Anti-PI4K2B
Provider product page
Atlas Antibodies - HPA004099
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LILPYISDMNFVQDLCEDLYELFKTDKGFDKATFE
SQMSVMRGQILNLTQALRDGKSPFQLVQIPCVIVE
RSQGGSQGRIVHLSNSFTQTVNCRKPF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -