HPA004099

PI4K2B antibody from Atlas Antibodies
FLJ11105, PI4KIIB, PIK42B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004099
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004099, RRID:AB_1855353
Product name
Anti-PI4K2B
Provider product page
Atlas Antibodies - HPA004099
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LILPYISDMNFVQDLCEDLYELFKTDKGFDKATFE
SQMSVMRGQILNLTQALRDGKSPFQLVQIPCVIVE
RSQGGSQGRIVHLSNSFTQTVNCRKPF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -