HPA004099

PI4K2B antibody from Sigma-Aldrich
FLJ11105, PI4KIIB, PIK42B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004099
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004099, RRID:AB_1855353
Product name
Anti-PI4K2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004099
Antibody type
Polyclonal
Antigen
Phosphatidylinositol 4-kinase type 2-beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LILPYISDMNFVQDLCEDLYELFKTDKGFDKATFE
SQMSVMRGQILNLTQALRDGKSPFQLVQIPCVIVE
RSQGGSQGRIVHLSNSFTQTVNCRKPF
Storage
-20C
Provider Type Product Number
- No reagents -