Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042865 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042865, RRID:AB_10797024
- Product name
- Anti-BLVRA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLN
LIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYI
CSESSSHEDYIRQFLNAGKHVL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Biliverdin reductase B impairs cholangiocarcinoma cell motility by inhibiting the Notch/Snail signaling pathway.
FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast.
Gao Z, Ni X, Zheng B, Sun W, Wan W, Liu H, Ni X, Suo T, Li N, Liu H, Shen S
Journal of Cancer 2022;13(7):2159-2170
Journal of Cancer 2022;13(7):2159-2170
FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast.
Gromov P, Espinoza JA, Talman ML, Honma N, Kroman N, Timmermans Wielenga V, Moreira JM, Gromova I
PloS one 2014;9(11):e112024
PloS one 2014;9(11):e112024
No comments: Submit comment
No validations: Submit validation data