HPA020291

SLIRP antibody from Atlas Antibodies
C14orf156, DC50
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020291
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020291, RRID:AB_1845563
Product name
Anti-SLIRP
Provider product page
Atlas Antibodies - HPA020291
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVR
RCILPFDKETGFHRGLGWVQFSSEEGLRNALQQEN
HIIDGVKVQVHTRRPKLPQTSDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -