HPA020291

SLIRP antibody from Sigma-Aldrich
C14orf156, DC50
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020291
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020291, RRID:AB_1845563
Product name
Anti-C14orf156 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020291
Antibody type
Polyclonal
Antigen
SRA stem-loop-interacting RNA-binding protein, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVR
RCILPFDKETGFHRGLGWVQFSSEEGLRNALQQEN
HIIDGVKVQVHTRRPKLPQTSDD
Storage
-20C
Provider Type Product Number
- No reagents -