ABIN182587
antibody from antibodies-online
Targeting: NCOR1
hCIT529I10, hN-CoR, KIAA1047, MGC104216, N-CoR, PPP1R109, TRAC1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182587 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Co-Repressor 1 (NCOR1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NCOR1 antibody: synthetic peptide directed towards the N terminal of human NCOR1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Canine
- Host
- Rabbit
- Antigen sequence
NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKE
EDKAE KTEKKEEEKK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Ligand-independent repression by the thyroid hormone receptor mediated by a nuclear receptor co-repressor.
Hörlein AJ, Näär AM, Heinzel T, Torchia J, Gloss B, Kurokawa R, Ryan A, Kamei Y, Söderström M, Glass CK
Nature 1995 Oct 5;377(6548):397-404
Nature 1995 Oct 5;377(6548):397-404
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry