Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP37176_T100 - Provider product page

- Provider
- Aviva Systems Biology
- Proper citation
- Aviva Systems Biology Cat#ARP37176_T100, RRID:AB_842538
- Product name
- SITPEC antibody - middle region (ARP37176_T100)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against SITPEC. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAA
LARHNPSRPVFVEGP- Vial size
- 100 µg
- Concentration
- 1 mg/ml
- Handling
- Add 100 µl of distilled water. Final anti-SITPEC antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image

- Experimental details
- WB Suggested Anti-SITPECAntibody Titration: 1.25µg/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate