HPA004101

SMARCD1 antibody from Atlas Antibodies
BAF60A, CRACD1, Rsc6p
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004101
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004101, RRID:AB_1080026
Product name
Anti-SMARCD1
Provider product page
Atlas Antibodies - HPA004101
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGP
SMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQ
QVQQQAVQNRNHNAKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -