HPA004101

SMARCD1 antibody from Sigma-Aldrich
BAF60A, CRACD1, Rsc6p
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004101
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004101, RRID:AB_1080026
Product name
Anti-SMARCD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004101
Antibody type
Polyclonal
Antigen
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGP
SMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQ
QVQQQAVQNRNHNAKK
Storage
-20C
Provider Type Product Number
- No reagents -