HPA018811

ELMO2 antibody from Sigma-Aldrich
CED-12, CED12, ELMO-2, FLJ11656, KIAA1834
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018811
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018811, RRID:AB_1848126
Product name
Anti-ELMO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018811
Antibody type
Polyclonal
Antigen
Engulfment and cell motility protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNG
TILQLAISPSRAARQLMERTQSSNMETRLDAMKEL
AKLSAD
Storage
-20C
Provider Type Product Number
- No reagents -