HPA018873

ACCS antibody from Sigma-Aldrich
ACS, PHACS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018873, RRID:AB_1855273
Product name
Anti-ACCS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018873
Antibody type
Polyclonal
Antigen
1-aminocyclopropane-1-carboxylate synthase-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVD
LRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFEC
KEPG
Storage
-20C
Provider Type Product Number
- No reagents -