HPA004102

TNFRSF1A antibody from Atlas Antibodies
CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004102
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004102, RRID:AB_1846232
Product name
Anti-TNFRSF1A
Provider product page
Atlas Antibodies - HPA004102
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLY
NDCPGPGQDTDCRECESGSFTASENHLRHCLSCSK
CRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSEN
LFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFL
RENECVSC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -