HPA004102

TNFRSF1A antibody from Sigma-Aldrich
CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004102
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004102, RRID:AB_1846232
Product name
Anti-TNFRSF1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004102
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 1A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLY
NDCPGPGQDTDCRECESGSFTASENHLRHCLSCSK
CRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSEN
LFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFL
RENECVSC
Storage
-20C
Provider Type Product Number
- No reagents -