HPA020265

DBNL antibody from Atlas Antibodies
ABP1, HIP-55, SH3P7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020265
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020265, RRID:AB_1850723
Product name
Anti-DBNL
Provider product page
Atlas Antibodies - HPA020265
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
INWTGEGVNDVRKGACASHVSTMASFLKGAHVTIN
ARAEEDVEPECIMEKVAKASGANYSFHKESGRFQD
VGPQAPVGSVYQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -