HPA027735

DBNL antibody from MilliporeSigma / Merck KGaA
ABP1, HIP-55, SH3P7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027735
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027735, RRID:AB_10603790
Product name
Anti-DBNL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027735
Antibody type
Polyclonal
Antigen
drebrin-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSG
QGLCARALYDYQAADDTEISFDPENLITGIEVIDE
GWWRGYGPDGH
Storage
-20C
Provider Type Product Number
- No reagents -