HPA001379

PRICKLE1 antibody from Atlas Antibodies
EPM1B, FLJ31937, RILP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001379
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001379, RRID:AB_1855703
Product name
Anti-PRICKLE1
Provider product page
Atlas Antibodies - HPA001379
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDS
LALSNITGASVDGENKPRPSLYSLQNFEEMETEDC
EKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILP
EEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYD
IEI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -