HPA001379

PRICKLE1 antibody from Sigma-Aldrich
EPM1B., FLJ31937, RILP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001379
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001379, RRID:AB_1855703
Product name
Anti-PRICKLE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001379
Antibody type
Polyclonal
Antigen
Prickle-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDS
LALSNITGASVDGENKPRPSLYSLQNFEEMETEDC
EKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILP
EEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYD
IEI
Storage
-20C
Provider Type Product Number
- No reagents -