HPA021547

NAA35 antibody from Atlas Antibodies
bA379P1.1, FLJ21613, FLJ22643, MAK10
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021547
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021547, RRID:AB_1853505
Product name
Anti-NAA35
Provider product page
Atlas Antibodies - HPA021547
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGK
VRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQ
FKEMSDLNKYSPPPQSPELYVAASKHFQQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -