HPA021547

NAA35 antibody from Sigma-Aldrich
bA379P1.1, FLJ21613, FLJ22643, MAK10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021547
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021547, RRID:AB_1853505
Product name
Anti-MAK10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021547
Antibody type
Polyclonal
Antigen
Protein MAK10 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGK
VRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQ
FKEMSDLNKYSPPPQSPELYVAASKHFQQ
Storage
-20C
Provider Type Product Number
- No reagents -