HPA006554

ACACB antibody from Atlas Antibodies
ACC2, ACCB, HACC275
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006554
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006554, RRID:AB_1233405
Product name
Anti-ACACB
Provider product page
Atlas Antibodies - HPA006554
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHT
LPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPR
NPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSS
ARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFD
DYSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -