HPA006554

ACACB antibody from Sigma-Aldrich
ACC2, ACCB, HACC275
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006554, RRID:AB_1844495
Product name
Anti-ACACB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006554
Antibody type
Polyclonal
Antigen
Acetyl-CoA carboxylase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHT
LPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPR
NPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSS
ARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFD
DYSS
Storage
-20C
Provider Type Product Number
- No reagents -