AV36171

ZNF441 antibody from MilliporeSigma / Merck KGaA
FLJ38637
No application information provided.

Antibody data

Product number
AV36171
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF441 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV36171
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF441 with an internal ID of S06903
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACEIKDNSQCGGPFTQTQDSIVNEKIPGVDPWESS
ECTDVLMGRSSLNCY
Storage
-20C