AV36172

ZNF491 antibody from Sigma-Aldrich
FLJ34791
No application information provided.

Antibody data

Product number
AV36172
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36172, RRID:AB_1859298
Product name
Anti-ZNF491 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36172
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF491 with an internal ID of P07527
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCESGTCGEIFMGYSSFNRNIRTDTGHQPHKCQKF
LEKPYKHKQRRKALS
Storage
-20C
Provider Type Product Number
- No reagents -