SAB2102891

ZNF491 antibody from Sigma-Aldrich
FLJ34791
No application information provided.

Antibody data

Product number
SAB2102891
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102891, RRID:AB_10607024
Product name
Anti-ZNF491 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102891
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_689569.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GERLFESAEGSQCGETFTQVPEDMLNKKTLPGVKS
CESGTCGEIFMGYSS
Storage
-20C
Provider Type Product Number
- No reagents -