HPA008422

NFKB2 antibody from Atlas Antibodies
LYT-10, NF-kB2, p105, p52
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008422
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008422, RRID:AB_1235029
Product name
Anti-NFKB2
Provider product page
Atlas Antibodies - HPA008422
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSG
SLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGP
ETRDKLPSTEVKEDSAYGSQSVEQEA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -