HPA008422

NFKB2 antibody from Sigma-Aldrich
LYT-10, NF-kB2, p105, p52
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008422
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008422, RRID:AB_1854434
Product name
Anti-NFKB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008422
Antibody type
Polyclonal
Antigen
Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSG
SLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGP
ETRDKLPSTEVKEDSAYGSQSVEQEA
Storage
-20C
Provider Type Product Number
- No reagents -