HPA014736

SLC13A3 antibody from Sigma-Aldrich
NADC3, SDCT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014736, RRID:AB_1856970
Product name
Anti-SLC13A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014736
Antibody type
Polyclonal
Antigen
Solute carrier family 13 member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEM
QFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNI
WKGFL
Storage
-20C
Provider Type Product Number
- No reagents -