Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310156 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Actinin, alpha 2 (ACTN2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VIASFRILASDKPYILAEELRRELPPDQAQYCIKR
MPAYS GPGSVPGALD- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SAP97 increases Kv1.5 currents through an indirect N-terminal mechanism.
Eldstrom J, Choi WS, Steele DF, Fedida D
FEBS letters 2003 Jul 17;547(1-3):205-11
FEBS letters 2003 Jul 17;547(1-3):205-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- WB Suggested Anti-ACTN2 Antibody Titration: 1.25 μg/mL Positive Control: Human heart
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry