HPA008315

ACTN2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008315
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008315, RRID:AB_1844543
Product name
Anti-ACTN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008315
Antibody type
Polyclonal
Antigen
Alpha-actinin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNI
RISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQ
EELARQHANERLRRQFAAQANAIGPWIQNKMEEIA
RSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLE
GD
Storage
-20C
Provider Type Product Number
- No reagents -