WH0007695M3

ZNF136 antibody from Sigma-Aldrich
pHZ-20
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0007695M3
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0007695M3, RRID:AB_1844277
Product name
Monoclonal Anti-ZNF136 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0007695M3
Antibody type
Monoclonal
Antigen
ZNF136 (NP_003428, a.a. 444-541) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
GEKPYECKQCGKAFSYLNSFRTHEMIHTGEKPFEC
KRCGKAFRSSSSFRLHERTHTGQKPYHCKECGKAY
SCRASFQRHMLTHAEDGPPYKCMWESL* (witho
ut GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -