Antibody data

Product number
H00007695-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007695-M03, RRID:AB_566278
Product name
ZNF136 monoclonal antibody (M03), clone 5E9
Provider product page
Abnova Corporation - H00007695-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF136.
Antigen sequence
GEKPYECKQCGKAFSYLNSFRTHEMIHTGEKPFEC
KRCGKAFRSSSSFRLHERTHTGQKPYHCKECGKAY
SCRASFQRHMLTHAEDGPPYKCMWESL
Isotype
IgG
Antibody clone number
5E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -