HPA021530

DGAT2L6 antibody from Sigma-Aldrich
DC3, FLJ25989
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021530
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021530, RRID:AB_2090953
Product name
Anti-DGAT2L6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021530
Antibody type
Polyclonal
Antigen
Diacylglycerol O-acyltransferase 2-like protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAWVRNWTLWKYFRNYFPVKLVKTHDLSPKHNYII
ANHPHGILSFGVFINFATEATGIARIFPSITPFVG
TLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQK
GSGNAVVIVVGGAAEALLCRPGASTLFLKQRKGFV
KMALQT
Storage
-20C
Provider Type Product Number
- No reagents -