HPA027024

EYA2 antibody from Sigma-Aldrich
EAB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027024
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027024, RRID:AB_1848334
Product name
Anti-EYA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027024
Antibody type
Polyclonal
Antigen
Eyes absent homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQ
YPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEAS
HNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHR
ASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD
Storage
-20C
Provider Type Product Number
- No reagents -