HPA026745

POLD2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026745
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026745, RRID:AB_1855520
Product name
Anti-POLD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026745
Antibody type
Polyclonal
Antigen
DNA polymerase delta subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTG
TVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLD
TDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQL
GDEGEQC
Storage
-20C
Provider Type Product Number
- No reagents -