Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182453 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hepatocyte Nuclear Factor 4, alpha (HNF4A) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the N terminal of human HNF4A
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLT
MGNDT SPSEGTNLNA- Vial size
- 50 µg
Submitted references Cohesin regulates tissue-specific expression by stabilizing highly occupied cis-regulatory modules.
A CTCF-independent role for cohesin in tissue-specific transcription.
Five-vertebrate ChIP-seq reveals the evolutionary dynamics of transcription factor binding.
Common variants of the hepatocyte nuclear factor-4alpha P2 promoter are associated with type 2 diabetes in the U.K. population.
Faure AJ, Schmidt D, Watt S, Schwalie PC, Wilson MD, Xu H, Ramsay RG, Odom DT, Flicek P
Genome research 2012 Nov;22(11):2163-75
Genome research 2012 Nov;22(11):2163-75
A CTCF-independent role for cohesin in tissue-specific transcription.
Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT
Genome research 2010 May;20(5):578-88
Genome research 2010 May;20(5):578-88
Five-vertebrate ChIP-seq reveals the evolutionary dynamics of transcription factor binding.
Schmidt D, Wilson MD, Ballester B, Schwalie PC, Brown GD, Marshall A, Kutter C, Watt S, Martinez-Jimenez CP, Mackay S, Talianidis I, Flicek P, Odom DT
Science (New York, N.Y.) 2010 May 21;328(5981):1036-40
Science (New York, N.Y.) 2010 May 21;328(5981):1036-40
Common variants of the hepatocyte nuclear factor-4alpha P2 promoter are associated with type 2 diabetes in the U.K. population.
Weedon MN, Owen KR, Shields B, Hitman G, Walker M, McCarthy MI, Love-Gregory LD, Permutt MA, Hattersley AT, Frayling TM
Diabetes 2004 Nov;53(11):3002-6
Diabetes 2004 Nov;53(11):3002-6
No comments: Submit comment
No validations: Submit validation data