Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182454 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hepatocyte Nuclear Factor 4, alpha (HNF4A) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQ
ASVIS HQHLSKQKQL- Vial size
- 50 µg
Submitted references Pathophysiologic study of goats with undulation pump total artificial heart: those that survived for more than 1 month.
Hepatocyte nuclear factor-4 alpha/gamma and hepatocyte nuclear factor-1 alpha as causal factors of interindividual difference in the expression of human dihydrodiol dehydrogenase 4 mRNA in human livers.
Baba A, Vasku J, Dobsak P, Saito I, Ishimaru M, Isoyama T, Takiura K, Ozeki T, Abe Y, Chinzei T, Imachi K
ASAIO journal (American Society for Artificial Internal Organs : 1992) 2003 Jul-Aug;49(4):463-8
ASAIO journal (American Society for Artificial Internal Organs : 1992) 2003 Jul-Aug;49(4):463-8
Hepatocyte nuclear factor-4 alpha/gamma and hepatocyte nuclear factor-1 alpha as causal factors of interindividual difference in the expression of human dihydrodiol dehydrogenase 4 mRNA in human livers.
Ozeki T, Takahashi Y, Nakayama K, Funayama M, Nagashima K, Kodama T, Kamataki T
Pharmacogenetics 2003 Jan;13(1):49-53
Pharmacogenetics 2003 Jan;13(1):49-53
No comments: Submit comment
No validations: Submit validation data