HPA004712

HNF4A antibody from Sigma-Aldrich
HNF4, MODY, MODY1, NR2A1, TCF14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004712
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004712, RRID:AB_1079075
Product name
Anti-HNF4A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004712
Antibody type
Polyclonal
Antigen
Hepatocyte nuclear factor 4-alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVI
VANTMPTHLSNGQMCEWPRPRGQAATPETPQPSPP
GGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV
Storage
-20C
Provider Type Product Number
- No reagents -