Antibody data

Product number
PAB22990
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22990, RRID:AB_11121220
Product name
LACTB polyclonal antibody
Provider product page
Abnova Corporation - PAB22990
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LACTB.
Antigen sequence
KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKND
FEQGELYLREKFENSIESLRLFKNDPLFFKPGSQF
LYSTFGYTLL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -