H00051422-B01P

PRKAG2 antibody from Abnova Corporation
AAKG, AAKG2, CMH6, H91620p, WPWS

Antibody data

Product number
H00051422-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051422-B01P, RRID:AB_1579121
Product name
PRKAG2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051422-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PRKAG2 protein.
Antigen sequence
MLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPT
SSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKK
QSFVGMLTITDFINILHRYYKSPMVQIYELEEHKI
ETWRELYLQETFKPLVNISPDASLFDAVYSLIKNK
IHRLPVIDPISGNALYILTHKRILKFLQLFMSDMP
KPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNI
FVERRISALPVVDESGKVVDIYSKFDVINLAAEKT
YNNLDITVTQALQHRSQYFEGVVKCNKLEILETIV
DRIVRAEVHRLVVVNEADSIVGIISLSDILQALIL
TPAGAKQKETETE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -