HPA004246

PRKAG2 antibody from Atlas Antibodies
AAKG, AAKG2, CMH6, H91620p, WPWS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004246
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004246, RRID:AB_887594
Product name
Anti-PRKAG2
Provider product page
Atlas Antibodies - HPA004246
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
STPTQVTKQHTFPLESYKHEPERLENRIYASSSPP
DTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAA
ALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSH
K
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -