Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004246 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004246, RRID:AB_1078151
- Product name
- Anti-PRKAG2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
STPTQVTKQHTFPLESYKHEPERLENRIYASSSPP
DTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAA
ALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSH
K- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Subunit composition of AMPK trimers present in the cytokinetic apparatus: Implications for drug target identification
Generation of digital responses in stress sensors.
Pinter K, Jefferson A, Czibik G, Watkins H, Redwood C
Cell Cycle 2014 October;11(5):917-921
Cell Cycle 2014 October;11(5):917-921
Generation of digital responses in stress sensors.
Martiáñez T, Francès S, López JM
The Journal of biological chemistry 2009 Sep 4;284(36):23902-11
The Journal of biological chemistry 2009 Sep 4;284(36):23902-11
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate to strong positivity in nuclear membrane in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong positivity in nuclear membrane in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
- Sample type
- HUMAN
