HPA004246

PRKAG2 antibody from Sigma-Aldrich
AAKG, AAKG2, CMH6, H91620p, WPWS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004246
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004246, RRID:AB_1078151
Product name
Anti-PRKAG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004246
Antibody type
Polyclonal
Antigen
5'-AMP-activated protein kinase subunit gamma-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STPTQVTKQHTFPLESYKHEPERLENRIYASSSPP
DTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAA
ALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSH
K
Storage
-20C
Provider Type Product Number
- No reagents -