HPA018116

TWF1 antibody from Sigma-Aldrich
A6, PTK9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018116
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018116, RRID:AB_1855899
Product name
Anti-TWF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018116
Antibody type
Polyclonal
Antigen
Twinfilin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISR
EAFQALEKLNNRQLNYVQLEIDIKNEIIILANTTN
TELKDLPKRIPKDSARYHFFLYKHSHEGDY
Storage
-20C
Provider Type Product Number
- No reagents -