HPA005681

RIOK2 antibody from Sigma-Aldrich
FLJ11159
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005681
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005681, RRID:AB_1856286
Product name
Anti-RIOK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005681
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase RIO2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPTFKDIRREDTLDVEVSASGYTKEMQADDELLHP
LGPDDKNIETKEGSEFSFSDGEVAEKAEVYRSENE
SERNCLEESEGCYCRSSGDPEQIKEDSLSEESADA
RSFE
Storage
-20C
Provider Type Product Number
- No reagents -