Antibody data

Product number
ABIN182716
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 624 (ZNF624) (Middle Region) antibody
Provider product page
antibodies-online - ABIN182716
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF624 antibody: synthetic peptide directed towards the middle region of human ZNF624
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNEC
GKAFI NYSCLTVHHR
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -