Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182716 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 624 (ZNF624) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF624 antibody: synthetic peptide directed towards the middle region of human ZNF624
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNEC
GKAFI NYSCLTVHHR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references [Lateral lumbar disk herniation].
Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
Dudek H, Michno T, Michalski J
Chirurgia narzadow ruchu i ortopedia polska 2000;65(1):65-70
Chirurgia narzadow ruchu i ortopedia polska 2000;65(1):65-70
Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2000 Feb 28;7(1):65-73
DNA research : an international journal for rapid publication of reports on genes and genomes 2000 Feb 28;7(1):65-73
No comments: Submit comment
No validations: Submit validation data