HPA023157

ZNF624 antibody from Atlas Antibodies
KIAA1349
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023157
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023157, RRID:AB_2671094
Product name
Anti-ZNF624
Provider product page
Atlas Antibodies - HPA023157
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQ
PDEDLHLQAEETQLVKESVTFKDVAIDFTLEEWRL
MD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -