Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - Western blot [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - ABIN1109604 - Provider product page

 - Provider
 - antibodies-online
 - Product name
 - anti-Zinc Finger Protein 624 (ZNF624) (Middle Region) antibody
 - Antibody type
 - Polyclonal
 - Antigen
 - The immunogen for anti-ZNF624 antibody: synthetic peptide directed towards the middle region of human ZNF624.
 - Description
 - Purified using peptide immunoaffinity column
 - Reactivity
 - Human, Mouse, Rat, Bovine, Canine
 - Host
 - Rabbit
 - Antigen sequence
 PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNEC
GKAFINYSCLTVHHR- Epitope
 - Middle Region
 - Vial size
 - 50 μg
 - Storage
 - Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
 - Handling
 - Avoid repeated freezing and thawing.
 
Submitted references		Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
				
		
	
			Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2000 Feb 28;7(1):65-73
		DNA research : an international journal for rapid publication of reports on genes and genomes 2000 Feb 28;7(1):65-73
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
 - antibodies-online (provider)
 - Main image
 
- Experimental details
 - Human Jurkat; WB Suggested Anti-ZNF624 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate; ZNF624 antibody - middle region (AP42159PU-N) in Human Jurkat cells using Western Blot