AV32956

ZNF624 antibody from Sigma-Aldrich
KIAA1349
No application information provided.

Antibody data

Product number
AV32956
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV32956, RRID:AB_1859384
Product name
Anti-ZNF624 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV32956
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF624 with an internal ID of P03980
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNEC
GKAFINYSCLTVHHR
Storage
-20C
Provider Type Product Number
- No reagents -